bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2747_orf2 Length=89 Score E Sequences producing significant alignments: (Bits) Value 349161.Dred_0205 94.4 1e-18 > 349161.Dred_0205 Length=181 Score = 94.4 bits (233), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 4/87 (4%) Query 2 AKVIYEFIKENKLENTEVLTIKAGLVEGKVINVEEVKALASLPSREVLIAKVLGSMQAPI 61 AK++ +F KE K + + IKAG++EGKVI+ VKALA LPSREVL+AKVLG MQAP+ Sbjct 96 AKILSDFAKEIK----QGVDIKAGILEGKVIDAAGVKALADLPSREVLLAKVLGGMQAPM 151 Query 62 SGVVNVLQGTIRNAVYVLDAIRAQKES 88 G VL +RN VYVLD +R QKE Sbjct 152 YGFAGVLAANLRNLVYVLDQVRQQKEG 178 Lambda K H 0.313 0.131 0.331 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23068210110 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40