bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2726_orf1 Length=471 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0120 131 4e-29 > 5833.PF08_0120 Length=491 Score = 131 bits (330), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 57/121 (47%), Positives = 85/121 (70%), Gaps = 5/121 (4%) Query 49 DDRRYVSEADRDEIFRRL--RKENRICFDCSSRNPTWISLTHAVFVCLSCSGKHRRLGTH 106 D+R YV + +D+ F+ + + EN+ CFDC ++NP W+SLT+A+F+CL+CSGKHR+LGTH Sbjct 15 DNRGYVLDTLKDKTFKIILNKNENKNCFDCGNKNPKWLSLTYAIFICLNCSGKHRQLGTH 74 Query 107 LSFVRSTEMDKIYPEQLFRMELGGNRRAHEFLREHGADLSQPLDYHGKLAAKHRQMLDRL 166 +SFVRST MDK +QL R+ LGGN +A E+L+ + +DY + K++ LD L Sbjct 75 ISFVRSTGMDKFTAKQLIRICLGGNMKASEYLKRSKDSI---IDYSSHVCLKYKMYLDNL 131 Query 167 V 167 + Sbjct 132 L 132 Lambda K H 0.313 0.128 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 199217143071 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40