bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2713_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0579 126 2e-28 > 5833.PF14_0579 Length=121 Score = 126 bits (316), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 58/98 (59%), Positives = 79/98 (80%), Gaps = 1/98 (1%) Query 8 LKPGRVVVVLNGRMAGKKGVVVSTSEG-TKERHFCYCLVAGIEKAPLRVSKRMSTTKVQK 66 LKPG+V+++LNGR AGKK V+V+T EG T+ER + YCLVAGIEK PL+V+K M+ K+ K Sbjct 5 LKPGKVIIILNGRRAGKKAVIVNTYEGQTRERPYSYCLVAGIEKHPLKVNKSMTKKKIVK 64 Query 67 RMRPKAFIRYVNVRHLMPTRYTVSNDFDVKALAPEASL 104 R + KAFI+ +NV H++PTRY V+NDFD+K+LA + L Sbjct 65 RSKVKAFIKCINVNHILPTRYQVANDFDIKSLASDDVL 102 Lambda K H 0.319 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40