bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2679_orf3 Length=137 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000010716 80.1 2e-14 > 69293.ENSGACP00000010716 Length=212 Score = 80.1 bits (196), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/92 (41%), Positives = 61/92 (66%), Gaps = 2/92 (2%) Query 36 SAGASSLAAQ-AEAVYRERQQIEEKMEALASFLTAEGMPGLKGPLVDPEGFPRADIDVHA 94 SAG S + + + +++ +IEE+++A L +G+ G++GPLVD EGFPRAD++V+ Sbjct 8 SAGGSEITMDDVKNLVKKKDEIEEQIKAYYDVLADQGV-GVEGPLVDAEGFPRADVNVYH 66 Query 95 VLQARQQLACLKTDHREVQQRLEETLLLLHAA 126 V AR +ACL+ DH+ + + +EE L LHA Sbjct 67 VRTARHSIACLQNDHKAIMEEIEEALHKLHAG 98 Lambda K H 0.316 0.127 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40