bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2631_orf1 Length=156 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0697 145 3e-34 > 5833.PF14_0697 Length=358 Score = 145 bits (367), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 69/144 (47%), Positives = 92/144 (63%), Gaps = 0/144 (0%) Query 13 GRLVMPMADDMHTHLRQVELMDMVTLQIRKGGCDRVLVMPNTVPPIVTCSQALEYRNELL 72 +P+ADDMH HLRQ +++D IR+GGC+RVLVMPNT P I TCS A +Y +L Sbjct 3 NYFYIPIADDMHCHLRQGDMLDFTVNSIRRGGCNRVLVMPNTHPIISTCSDAQKYLYQLK 62 Query 73 KRDPNVNYLMTLYLCREIDADDIAKRAKESHVVGVKLYPRGVTTNSEAGVEDLTQYEGVF 132 RD ++ YLMTLYL + D +DI + ++ GVK+YP VTTNS G+ L Y VF Sbjct 63 SRDDDIEYLMTLYLNKNTDENDILSNYYKCNLQGVKIYPSNVTTNSSDGITSLEPYYKVF 122 Query 133 KVMEELGMSLHIHAEKPDAPTLRA 156 +E+L S+HIH E+P+ L A Sbjct 123 HALEKLNKSIHIHCEEPNINPLYA 146 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 24371502831 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40