bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2584_orf1 Length=196 Score E Sequences producing significant alignments: (Bits) Value 224914.BMEI0817 117 2e-25 > 224914.BMEI0817 Length=149 Score = 117 bits (293), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 51/120 (42%), Positives = 79/120 (65%), Gaps = 4/120 (3%) Query 46 SSSRMSSTQQKPYDPDNVFAKILDGRLPCHKIFETESCIAILDAFPTAQGHALLISKAPA 105 +RMS+T YD +N+FAKIL G +P +++ET+S +A +D P +GH L++ KAP+ Sbjct 6 GENRMSAT----YDDNNIFAKILRGEIPSTRVYETDSVVAFMDVMPQGKGHTLVVPKAPS 61 Query 106 LTIMDLSEQQAGDVLKELPRLCRAVQKATNCDAVNVLHNGGAAAGQIVHHLHFHVVPRFE 165 ++D + DV++ + ++ AV+KA N D V V+ A+GQ V+HLHFHV+PRFE Sbjct 62 RNLLDARPETLADVIQAVQKIANAVKKAFNADGVTVMQFNEPASGQTVYHLHFHVIPRFE 121 Lambda K H 0.321 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46123291875 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40