bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2573_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value 8364.ENSXETP00000046845 148 6e-35 > 8364.ENSXETP00000046845 Length=178 Score = 148 bits (374), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 70/158 (44%), Positives = 101/158 (63%), Gaps = 8/158 (5%) Query 23 AEMKADKTLQQPIRQFQVVGRQRPAAAAAAAAAATPAYRLRLFAANEVLAVSRFWYLLRQ 82 MKA TL R+++V+GR P A + P YR+R+FA N V+A SRFWY + Q Sbjct 1 GSMKASGTL----REYKVIGRSLPTPKAPSP----PLYRMRIFAPNHVVAKSRFWYFVSQ 52 Query 83 LRKIKRAHGEVLEVVEINPKRATNPKNFGVWLRYDSRTGSHNMYKEVRDISENAAAAQVL 142 L+K+K++ GE++ ++ K KNFG+WLRYDSR+G+HNMY+E RD++ AA Q Sbjct 53 LKKMKKSSGEIVYCGQVYEKTPLKVKNFGIWLRYDSRSGTHNMYREYRDLTTAAAVTQCY 112 Query 143 AEMAGRHRALASNIQIIRIVQLKGSECRRPHVQQMLSS 180 +M RHRA A IQI+++ + S+CRRP ++Q S Sbjct 113 RDMGARHRARAHAIQIMKVEVIPASKCRRPAIKQFHDS 150 Lambda K H 0.323 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37047630060 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40