bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2572_orf2 Length=173 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000007799 84.7 1e-15 > 69293.ENSGACP00000007799 Length=854 Score = 84.7 bits (208), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 43/97 (44%), Positives = 62/97 (63%), Gaps = 1/97 (1%) Query 18 MDPFIAAPSLITSGDGWTEHISKEGRKYYYNTLTQESQWGKPLSLQTPEEAQILLKTGWQ 77 +DP +AAP WTEH S +G+ Y+YNT T++S W KP L++P E Q+L K W+ Sbjct 85 VDPSVAAPGTAHQKSLWTEHKSLDGKTYFYNTETKQSTWEKPEDLKSPAE-QMLSKCPWK 143 Query 78 EFCSADGKSYWFHSATKRSVWNTPKEVEEMLKSLKEE 114 E+ S GK Y+++S TK S W PKE+E++ +K E Sbjct 144 EYKSDTGKPYYYNSQTKESRWTKPKELEDLEAMIKAE 180 Lambda K H 0.313 0.128 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 33476963958 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40