bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2540_orf1 Length=162 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G27380.1 116 2e-25 > 3702.AT3G27380.1 Length=279 Score = 116 bits (290), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 2/107 (1%) Query 56 PAGVSAACRLLFPRASPVLSGLVSQQRASFSSNAGGTNLTFRIHRYDPEKGGRPHMQEYT 115 P+ ++ A RL+ R + +G ++ +AS G TF+I+R++P+ G+P +Q Y Sbjct 14 PSKLATAARLIPARWTS--TGAEAETKASSGGGRGSNLKTFQIYRWNPDNPGKPELQNYQ 71 Query 116 LDTSTCGPMVLDALIAIKDRQDPTLTFRRSCREGICGSCAMNIDGIN 162 +D CGPMVLDALI IK+ DP+LTFRRSCREGICGSCAMNIDG N Sbjct 72 IDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCN 118 Lambda K H 0.320 0.132 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 27386790332 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40