bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2531_orf1 Length=195 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_2840 130 2e-29 > 5807.cgd4_2840 Length=223 Score = 130 bits (327), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 68/142 (47%), Positives = 91/142 (64%), Gaps = 12/142 (8%) Query 53 LDLAKGREGSLQLLEGFQHRKLLQQENRS------------IADVRPDITHQCLIALQES 100 L+L + ++ SL+LL G H K +E S I ++RPDI HQCL++L +S Sbjct 7 LELYEKKDKSLELLNGIDHPKKKIEEYCSLYSSKIFSKEEMILNIRPDILHQCLLSLLDS 66 Query 101 PLNKAGRLCVFIRTQSGQLIEVHPQLRVPPTYDEFRKLMINLLHTRRIRAVEKNVTLMQV 160 PLNK+GRL V+IRT S LIEV+PQL VP ++ EF LM+NLL R+I AV N +LM++ Sbjct 67 PLNKSGRLLVYIRTMSNVLIEVNPQLSVPRSFKEFSSLMVNLLVKRKITAVNGNTSLMRI 126 Query 161 TKNDANLFLPVGSRKIALSTQG 182 KND + LPVG +K LS G Sbjct 127 VKNDIDKILPVGGKKYGLSLNG 148 Lambda K H 0.322 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 45508314650 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40