bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2506_orf1 Length=153 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb10.61.0880 112 4e-24 > 5691.Tb10.61.0880 Length=362 Score = 112 bits (279), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 54/82 (65%), Positives = 66/82 (80%), Gaps = 2/82 (2%) Query 74 MPEPRRALITGITGQDGSYLSELLLQKGYEVHGIIRRSSTVNTERL--LPVSQRIHLHFG 131 M R ALITGITGQDGSYL+ELLL+KGY+VHGI+RRSS++NT R+ L + +HLH+G Sbjct 1 MSARRLALITGITGQDGSYLAELLLKKGYDVHGIVRRSSSLNTGRIDHLVGNAHLHLHYG 60 Query 132 DMVDSSSLFDIISRVRPHEVYN 153 DM D + L I+SRVRPHEVYN Sbjct 61 DMTDGAGLHQIVSRVRPHEVYN 82 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40