bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2496_orf2 Length=182 Score E Sequences producing significant alignments: (Bits) Value 306537.jk0110 72.4 6e-12 > 306537.jk0110 Length=242 Score = 72.4 bits (176), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 44/129 (34%), Positives = 58/129 (44%), Gaps = 15/129 (11%) Query 59 FTSMSLLNSSSGLSVGSSPAAAAAAAPAAAAAAGAPPAGAAAAPAAAPAAAAAAAPPAAA 118 F + LNS P A P A G P P + Sbjct 5 FDRIMALNSKG-------PYRAERVGPEDALKGGRTPVLENPQPNVVLGTPLTGLEDSYW 57 Query 119 AAAE------SIVLGGGCFWGLEKLFVEEFKDKLEATCVGYAGGHTPQPTYAQVCSSKTG 172 A A+ IVLG GCFWG+E++F D + T VGYAGG+TP PTY +VC+ +TG Sbjct 58 AEADGLEQPAQIVLGLGCFWGVERMFW--GVDGVWGTSVGYAGGYTPNPTYREVCTGRTG 115 Query 173 HFEALKISF 181 H E +++ F Sbjct 116 HAEVVRVIF 124 Lambda K H 0.321 0.131 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38282551062 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40