bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2487_orf1 Length=191 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0208 268 5e-71 > 5833.PF11_0208 Length=250 Score = 268 bits (686), Expect = 5e-71, Method: Compositional matrix adjust. Identities = 127/189 (67%), Positives = 154/189 (81%), Gaps = 0/189 (0%) Query 3 RAVETCWTVLMHSNQCYLPIKNTWRLNERHYGALQGLNKAETAAKHGEEQVKIWRRAYAV 62 RA+ T W VL ++ ++P+ TWRLNERHYG+LQGLNK+ETA K+GEEQVKIWRR+Y + Sbjct 62 RAICTAWNVLKTADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYDI 121 Query 63 PPPPLDPEDKRNAKFEEKYKHLPQEVLPLTECLKDTVERVLPYYFDEIAPALLDNKKVLV 122 PPP LD ED R YK++P++ LP TECLKDTVERVLP++FD IAP +L NKKV+V Sbjct 122 PPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVMV 181 Query 123 VAHGNSLRGLVKHLDGMSEEEVLELNIPTAVPLVYELDESLKPLKKYYLLDEAEVQKRIA 182 AHGNSLRGLVKHLD +SE +VLELNIPT VPLVYELDE+LKP+K YYLLD E++K++ Sbjct 182 AAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKMD 241 Query 183 AVANQGKAK 191 VANQGKAK Sbjct 242 EVANQGKAK 250 Lambda K H 0.315 0.133 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43048405750 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40