bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2479_orf1 Length=190 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G42890.1 79.3 6e-14 > 3702.AT5G42890.1 Length=123 Score = 79.3 bits (194), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 3/120 (2%) Query 71 AGSCSKAEKIFKMLAAYLELDKEKTQQLKTKVNSCFLFEIAAKQQQQPVLQWTIDLRQDG 130 A + K++ I M+ +L D K ++ K+ + IA K+ + + +DL++ G Sbjct 2 ANTQLKSDAIMDMMKEHLSTDAGK--EVTEKIGLVYQINIAPKKLGFEEVTYIVDLKK-G 58 Query 131 EGCAKAGVWGAADATFAVGEEAFCRICLGELNPQVAFLQGKMKIKGSMAAAAKFTPQLFP 190 E G DATF+ ++ F ++ G++NPQ+AF++G MKIKGS++AA KFTP +FP Sbjct 59 EVTKGKYEGGKVDATFSFKDDDFVKVATGKMNPQMAFIRGAMKIKGSLSAAQKFTPDIFP 118 Lambda K H 0.315 0.128 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 42433428525 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40