bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2475_orf1 Length=212 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.209 252 5e-66 > 5833.MAL13P1.209 Length=193 Score = 252 bits (643), Expect = 5e-66, Method: Compositional matrix adjust. Identities = 128/185 (69%), Positives = 142/185 (76%), Gaps = 1/185 (0%) Query 28 GIDLKNRGRTKKHGRRALVSENPYLRLAVKLYQFLARRTNSNFNKVILKRLMAPRRLRAP 87 GI LKN GR KKHGR+ LVS+NPYLRL VKLY FLARRTN+NFNK+I KRL+ P+R R P Sbjct 8 GIALKNVGRIKKHGRKHLVSKNPYLRLLVKLYNFLARRTNANFNKIIAKRLIMPKRYRPP 67 Query 88 LSMSKLAMRMRKEENKTAVVVGSIVDDPRTLQIPKMSVCALRFSETARKRILAAGGECLT 147 LS+SKL M N AVVVGSI DD R + ++ VCALRF+ETARKRI AGGECLT Sbjct 68 LSLSKLQYHMANHPNDIAVVVGSITDDKRLFSLKQLKVCALRFTETARKRIEDAGGECLT 127 Query 148 FDQLALKAPKGSNCVLLRG-SILREADKHFGPAPGTPHSHTKPYVRSKGRKFEMARGRRK 206 FDQLALK P G CVLLRG + R A+KHFG APG P S +PYVRSKGRKFE ARGRRK Sbjct 128 FDQLALKYPTGKKCVLLRGPTKARTAEKHFGKAPGKPKSKARPYVRSKGRKFEKARGRRK 187 Query 207 SRGYK 211 SR YK Sbjct 188 SRAYK 192 Lambda K H 0.322 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 54290949897 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40