bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2474_orf3 Length=135 Score E Sequences producing significant alignments: (Bits) Value 51511.ENSCSAVP00000012484 116 2e-25 > 51511.ENSCSAVP00000012484 Length=123 Score = 116 bits (291), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 67/123 (54%), Positives = 85/123 (69%), Gaps = 0/123 (0%) Query 13 MVGITAHELRQKAPKDLQKQLEDLKKELSLLRVAKVTGATPAKLAKITQVRKGIARVLTV 72 M I A ELR K+ +L KQL D K+ELS LRVAKVTG +KL+KI VRK IARVLTV Sbjct 1 MARIKAKELRGKSKDELLKQLNDFKQELSTLRVAKVTGGAASKLSKICLVRKSIARVLTV 60 Query 73 YNQKRREEAKKFFKGCKHKPKDLRLKKTRAIRQRLTLSQRRKMTVRRTKRVQNVPRRKYA 132 NQ ++E +K FKG KHKPKDLR KKTRA+R+RL + + + K+ + P+RK+A Sbjct 61 INQTQKENLRKLFKGKKHKPKDLRPKKTRALRRRLNKYEENLKSAKALKKARLYPQRKFA 120 Query 133 LLA 135 + A Sbjct 121 IKA 123 Lambda K H 0.321 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40