bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2458_orf1 Length=161 Score E Sequences producing significant alignments: (Bits) Value 233150.MGA_0877 105 5e-22 > 233150.MGA_0877 Length=396 Score = 105 bits (261), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 2/98 (2%) Query 64 SQPGNLYATLGLQRSASPTEVKKAYRKLSMKFHPDKNKSPDAEAKFREISYAYEVLSNAE 123 S + Y L + RSA+ ++KKA+RKL+MK+HPD+NK DAE KF+E++ AYEVLS+ E Sbjct 7 SSKRDYYEILEVSRSATQQDIKKAFRKLAMKYHPDRNKDSDAEEKFKEVNEAYEVLSDEE 66 Query 124 KRKVYDTQGHAGLERLQQGAGQDSGHPFDVFSEFFGGF 161 KRK+YDT GH GL G Q +P+DVF+ F GF Sbjct 67 KRKLYDTYGHEGLN--ASGFHQGGFNPYDVFNSVFSGF 102 Lambda K H 0.322 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26764363279 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40