bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2404_orf1 Length=170 Score E Sequences producing significant alignments: (Bits) Value 4896.SPBC3D6.08c 97.1 2e-19 > 4896.SPBC3D6.08c Length=140 Score = 97.1 bits (240), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 48/112 (42%), Positives = 75/112 (66%), Gaps = 1/112 (0%) Query 53 SLEEELDKKILVILRDGKNLIGVLRSFDQFGNLMLEGCVHRIIVNTFYNDVYQGVMIIRG 112 SL + +D+K++V+LRDGK LIG+LRSFDQF NLML+ + RI V+ Y D+ +GV I+RG Sbjct 15 SLVDYVDRKVIVVLRDGKKLIGILRSFDQFANLMLQYTIERIYVDDMYGDIDRGVYIVRG 74 Query 113 ENILLFGALDESKP-NPLESRPLWEVLEMHEEQEKHESRRRRNLRRLGDFLY 163 EN++L G LD K + ++ E++ + HE +++N+R G +L+ Sbjct 75 ENVVLLGELDLDKEYDAVKQLRRMPAEELYPLAKLHEEEKKKNIREKGKYLH 126 Lambda K H 0.319 0.139 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 31617132627 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40