bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2396_orf1 Length=172 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_3000 130 2e-29 > 5807.cgd1_3000 Length=162 Score = 130 bits (327), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 80/155 (51%), Positives = 109/155 (70%), Gaps = 3/155 (1%) Query 19 KFANKVDKMVKLLKPGRVVVVLNGRMAGKKGVVVSTSE-GTKERHFCYCLVAGIEKAPLR 77 K + KM KL+K GRVVV+LNGR AGKK VVV+T E GTK+R F + LVAG+EKAPL+ Sbjct 10 KLGRNLLKMAKLMKQGRVVVLLNGRYAGKKAVVVNTFESGTKDRPFPFVLVAGVEKAPLK 69 Query 78 VSKRMSTTKVQKRMRPKAFIRYVNVRHLMPTRYTVSNDFDVKALAPEASLEDSAMRKSAK 137 V KR+S K++K+ K F++ +N+ H+MPTRY VS DFD+K L ++++ +K A Sbjct 70 VHKRLSKEKLKKKSTIKPFLKSINMNHVMPTRYVVS-DFDIKPLLQGIDMQEADGKKQAL 128 Query 138 KALANIFYEKFMNPVNEKAGKVSKDVLFLRKKLRF 172 +AL F +K +N +EK GK KD++FLRK LRF Sbjct 129 RALHLAFNDKLINIQSEK-GKAPKDLIFLRKPLRF 162 Lambda K H 0.323 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32857020181 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40