bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2304_orf1 Length=220 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0410w 81.3 2e-14 > 5833.PFL0410w Length=3525 Score = 81.3 bits (199), Expect = 2e-14, Method: Composition-based stats. Identities = 42/112 (37%), Positives = 60/112 (53%), Gaps = 5/112 (4%) Query 1 STSVSVGGCVPCKKDFYCPGFLLGLMSCKNNSITAGVGAESVFQCKCPKGYGRVTGRNPL 60 S S++ C C+ + YC G + C NSIT + + S C C KGYGR+ Sbjct 1076 SYSMNKSICSICRYNNYCLGLDHSSIICPKNSITIKLKSVSALDCLCIKGYGRIIINTNQ 1135 Query 61 DLSLTCAPCPVNYFQ--HMEGVDAECIPCPSNSMTKSTMSSSITSCVAMPGF 110 +++C PCP N FQ H G +CIPCP ++ TK T ++SIT C+ G+ Sbjct 1136 SFTISCIPCPYNTFQPHHSYG---KCIPCPPHTFTKITGATSITECIPKMGY 1184 Lambda K H 0.318 0.131 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 59171035281 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40