bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2286_orf1 Length=243 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1270 81.6 2e-14 > 5807.cgd4_1270 Length=278 Score = 81.6 bits (200), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 49/143 (34%), Positives = 74/143 (51%), Gaps = 15/143 (10%) Query 102 VAGLVSTTNGDGSDLQGLF--EAPAGDSGVDSLRLDSDGNLVVADGPKEVFCCRCLGMSG 159 G+ N + S L LF + GDS L +D G++++ + + + G Sbjct 115 FEGINGENNSNNSFLSELFSMDKLNGDSNS-KLSIDCKGDIILEENLLNNSSGKQMDWLG 173 Query 160 LLGGGCMCTSGQQRRVLEEDLTSRGAFVLQPYEGAYKKTKGKRWTEEETRKFYECLSSCG 219 L+ G R + E++ LQPY GAYK+TKGKRW+ E+T KFY+ LS G Sbjct 174 LMEG---------RVYINENMAGTS---LQPYSGAYKRTKGKRWSTEQTNKFYDALSLFG 221 Query 220 TDLLLIRTMMPGVTDGQLKRKLK 242 TDL+L++++ P TD Q+ K K Sbjct 222 TDLMLVKSVFPEFTDKQIHDKFK 244 Lambda K H 0.315 0.131 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 71395206278 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40