bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2261_orf3 Length=138 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G10810.1 112 2e-24 > 3702.AT5G10810.1 Length=109 Score = 112 bits (281), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 47/101 (46%), Positives = 71/101 (70%), Gaps = 0/101 (0%) Query 38 QQHTILLVQFGDRRETKTYMEFASVAAAMNGVCQLYEQALKGAEPRLRQITYDVNDLFSY 97 +HTI+L+Q R T+T+M++ S+ AM+G+C LYE+ LK P LR I+YD+ DL+++ Sbjct 7 SRHTIILLQNSPSRATRTFMDYDSIGQAMDGICGLYERKLKEINPSLRNISYDIADLYNF 66 Query 98 LDSLNDLCALVHDSELNAYAPHNKAWIKDQVFKHLKRQARA 138 +D L DL ALV+D ++AY P+++ WIK + F HLKR A Sbjct 67 IDGLADLSALVYDHSISAYLPYDRQWIKQKAFHHLKRIANG 107 Lambda K H 0.320 0.128 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40