bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2198_orf1 Length=117 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_130 89.7 2e-17 > 5807.cgd2_130 Length=112 Score = 89.7 bits (221), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 60/116 (51%), Positives = 78/116 (67%), Gaps = 4/116 (3%) Query 2 MAMKYVAAYLMTVLGGNEAPTAADVSRVLEAVGAEVNPEVLKTLIDAMQGKAAHEVISAG 61 M MKYVAAYL+ V G E PTA+D+ +VLE+VG E + ++ LI M GK +HEVI++G Sbjct 1 MGMKYVAAYLLCVSSGKEQPTASDIKKVLESVGIEYDQSIIDVLISNMSGKLSHEVIASG 60 Query 62 LEKLQKVPCGGGAAAAAPAAAAAAGGGDSSSAAKETKKEEPEEEEEDGDMGLSLFD 117 L KLQ VP GG A + AAA+ DS+ A K+ + EEEEE+GD+G SLFD Sbjct 61 LSKLQSVPTGGVAVSGGAAAASGGAAQDSAPAEKKKE----EEEEEEGDLGFSLFD 112 Lambda K H 0.306 0.124 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22540005152 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40