bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2195_orf1 Length=144 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0021 65.5 5e-10 > 5833.PF13_0021 Length=211 Score = 65.5 bits (158), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 14/106 (13%) Query 38 LLQWPASSSSSSNWFSHSSCIPRLDIRDTGDNLLLHADLPGLDKKDIKVETQNGRLIIRG 97 LL P SS + +S+ +P +D+ D +L + D+PGL+K+D+++ +G+L I G Sbjct 86 LLSKPFSSMFRRDGYSN---VPAMDVLDKEKHLEIKMDVPGLNKEDVQINLDDGKLEISG 142 Query 98 HSSSSSSSSSSPQQQQQQQQQQDGRWFVQERCSSSFFRSLPLPPEA 143 S +Q+ +QQ R++++ERC SSF+RS LP Sbjct 143 EFKKS-------HEQKDEQQ----RYYIKERCESSFYRSFTLPENV 177 Lambda K H 0.310 0.123 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22567178795 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40