bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2173_orf1 Length=1247 Score E Sequences producing significant alignments: (Bits) Value 8364.ENSXETP00000029096 65.9 1e-08 > 8364.ENSXETP00000029096 Length=252 Score = 65.9 bits (159), Expect = 1e-08, Method: Composition-based stats. Identities = 33/92 (35%), Positives = 61/92 (66%), Gaps = 7/92 (7%) Query 183 QLQPGPQHSFQPPAVPQPQLQMQPQLQPQLQPQFQPQFQPQLQQPLQSQLQFQAQPQPQH 242 +L+PG Q QP + Q ++QP++Q ++QP+ Q + QP++Q +Q ++Q + QP+ Q Sbjct 119 KLEPGIQTELQP----KIQTELQPKIQTEIQPKIQTEIQPKIQTEIQPKIQTEIQPKIQT 174 Query 243 QMQPQVQPQMQPQAQAQRQGPI---VLSKLRT 271 ++QP++Q ++QP+ Q + Q I +L +LRT Sbjct 175 EIQPRIQTEIQPKIQTEIQPRIQTEILPELRT 206 Lambda K H 0.316 0.131 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 628549043967 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40