bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2167_orf1 Length=200 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.78 85.5 9e-16 > 5833.MAL8P1.78 Length=172 Score = 85.5 bits (210), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 48/135 (35%), Positives = 75/135 (55%), Gaps = 9/135 (6%) Query 70 PNTVFEVACAAAKKQQINLRPQCDISFDSKSSQIIFALDLPGFNKQDVHVEVENRCVTIS 129 PNTV E+ K+QI RP+ DI +D+ + I LD+PGF +D+ VE+ +T++ Sbjct 41 PNTVLEIEPDNNLKKQITFRPKVDIMYDADKCEAILVLDIPGFKIEDIDVEIGEGMLTVA 100 Query 130 GERPRPAADSEETMKSLL----RERNFGGFCRSFQLPPNAIEDAISAVFENGVLFVRIST 185 G PR + ET L +ER G F R F+LP N ++D A ++NG+L +++ Sbjct 101 G--PRSQTELFETYGDSLVLHAKEREVGYFKRIFKLPNNILDDTAKATYKNGILEIKMEC 158 Query 186 SDPKASSEKKKVSID 200 K S+ KV+I+ Sbjct 159 ---KQFSDMHKVTIN 170 Lambda K H 0.315 0.131 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47774528022 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40