bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2149_orf2 Length=112 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0026 79.3 3e-14 > 5833.PF14_0026 Length=490 Score = 79.3 bits (194), Expect = 3e-14, Method: Composition-based stats. Identities = 30/69 (43%), Positives = 54/69 (78%), Gaps = 0/69 (0%) Query 2 MTERWISQKKHYCQICNTWLSGHIVNVKKHEQSTRHLENARQQLKDAYQRHQDKQKQESL 61 MT+ W+S KKHYC+ CN W+SGH VN+K HE+S RH+EN ++ + ++++R + + +++ Sbjct 1 MTDYWVSSKKHYCETCNVWISGHKVNIKNHEKSARHIENFKRLINESFKRKEKETQEKEF 60 Query 62 LQRELQRME 70 L++EL+R++ Sbjct 61 LEKELRRLD 69 Lambda K H 0.315 0.123 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40