bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2116_orf1 Length=181 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000049721 82.0 8e-15 > 7955.ENSDARP00000049721 Length=153 Score = 82.0 bits (201), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 46/137 (33%), Positives = 79/137 (57%), Gaps = 6/137 (4%) Query 25 NLGSLTLDQCSSLVRRAEAEVENLSNHLSQLKFAASRVSEAREAVIQLDAYRQRQKEGEA 84 NL L+L Q L + + E E LS+ ++QLK ++ EA++++ L+ K E Sbjct 4 NLTELSLPQLEGLKTQLDQETEFLSSSIAQLKVVQTKYVEAKDSLNVLN------KSNEG 57 Query 85 PEVLVPLTGALYVKGRLDCDDKVLVDIGAGYMIQKTYQDEKKDAMRILTFMSEQQARLEK 144 E+LVPLT ++YV G+L D VLVD+G GY ++K +D K+ R + F+++Q +++ Sbjct 58 KELLVPLTSSMYVPGKLHDVDHVLVDVGTGYFVEKNVEDGKEFFKRKIDFLTKQIEKIQP 117 Query 145 IISDKVKQLQVLVATLN 161 + +K Q +V +N Sbjct 118 ALQEKYAMKQAVVEVMN 134 Lambda K H 0.316 0.129 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37665090561 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40