bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2105_orf2 Length=147 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL1P2.32 86.7 2e-16 > 5833.MAL1P2.32 Length=1710 Score = 86.7 bits (213), Expect = 2e-16, Method: Composition-based stats. Identities = 56/147 (38%), Positives = 83/147 (56%), Gaps = 7/147 (4%) Query 1 IDIGPERAARLLELLRKDANFLVTHGLMDYSLLVGIYY-STSGTAASRPGGSFSRVPLPA 59 I+IGPE RLL++L+ DA+FL + L+DYSLL GI+Y S + +++ Sbjct 1569 INIGPENKERLLKVLKADADFLKENMLLDYSLLFGIHYRELSKDVVNWEETKTNQINHIY 1628 Query 60 ALTNEPIPSASTDTDVPFWRRDLGGLASRDGSKLYYVGIIDVLTKWGAFKRTENAIRVVQ 119 I S PF + D GG+ S D K+++ GIID+ TKW K+ E+ R +Q Sbjct 1629 DYKGNCIASR------PFHQCDYGGIISVDKKKIFFFGIIDIFTKWSIKKKFEHTFRTIQ 1682 Query 120 TCDSYGISCVNPAFYASRFISFLERHI 146 D ISC++P YA RF++F+E H+ Sbjct 1683 KFDGKNISCIHPNAYAKRFVTFIENHM 1709 Lambda K H 0.322 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40