bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2102_orf1 Length=245 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_1180 104 3e-21 > 5807.cgd1_1180 Length=877 Score = 104 bits (259), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 62/141 (43%), Positives = 82/141 (58%), Gaps = 11/141 (7%) Query 2 LKDSLSTDIVKDLFQLRE-TRSDTHDMLQCQRCQPSRETEPLGMVAQLVDGFEEDDLLTW 60 LKDS+S D+V+DLF L+E T SDTHDM+QC RC S +PL MV Q G E DDL TW Sbjct 668 LKDSISADLVRDLFTLKEDTISDTHDMIQCNRCHDS-NGQPLDMVPQ-TTGLE-DDLNTW 724 Query 61 AHHSDLKTVPDEMLLKAIEAAEGD----AADALSSDTHEAPTEIPSHFQPVSFAMSCKVE 116 H+ +PDE+L + + A D H P E+PS FQPVSF M+C++E Sbjct 725 GHYHSFSEIPDEILSLTLNECSNETNKMAVDMEGEKPH--PLELPSDFQPVSFVMACRIE 782 Query 117 FT-KESEETNSAGAPAPKKVN 136 +E E+T + P +V+ Sbjct 783 LQDQEDEQTKESNGEKPMEVD 803 Lambda K H 0.308 0.124 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 72605294520 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40