bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2076_orf1 Length=194 Score E Sequences producing significant alignments: (Bits) Value 5833.PF07_0080 147 2e-34 > 5833.PF07_0080 Length=137 Score = 147 bits (370), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 69/125 (55%), Positives = 95/125 (76%), Gaps = 5/125 (4%) Query 46 KPSLIPKKNRRMIYEYLFKEGVLVVQKNPKLEKHPEIAVPNLHVMMVMKSLKSKDFCEEM 105 K S IPK+N+++IYEYLFKEGV+VV+K+ K+ +HP + VPNLH+MM +KSLKS+++ EE Sbjct 10 KYSYIPKQNKKLIYEYLFKEGVIVVEKDAKIPRHPHLNVPNLHIMMTLKSLKSRNYVEEK 69 Query 106 FNWHHNYYTLKNEGMEYLRDYLRLPPTVFPATLTKKTPARAQRAGPEADAGAEVENWRVG 165 +NW H Y+ L NEG+EYLR++L LPP++FPATL+KKT RA + + D +V R Sbjct 70 YNWKHQYFILNNEGIEYLREFLHLPPSIFPATLSKKTVNRAPKM--DEDISRDV---RQP 124 Query 166 MNRGR 170 M RGR Sbjct 125 MGRGR 129 Lambda K H 0.317 0.133 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 44893337425 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40