bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2054_orf1 Length=201 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_3810 70.9 2e-11 > 5807.cgd4_3810 Length=504 Score = 70.9 bits (172), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 50/179 (27%), Positives = 87/179 (48%), Gaps = 21/179 (11%) Query 38 PYDRELFMAFLAATTRLFCDDEQIVVVDFLASEEKAFTERELIDRLGWPDKRVREVCASL 97 PY+ E F F+ RLF D I+V D L E+K+FT+R+L +L D++VRE L Sbjct 19 PYNPENFKTFVQILLRLFHDSPAIIVGDCLIREQKSFTDRDLATKLNLSDRQVREALRQL 78 Query 98 ERLMLIQKEQ--LSAASAQALSNASADGDTTSSVGGTTDI-GRGSMPGGAALLGSGASSA 154 E +++ K+Q + + + S+ ++ +TD+ + S G GSG++SA Sbjct 79 EEDLIVVKDQKSNDGSQSNSSSSDQFSNKNNGTLNFSTDLESKYSSNQG----GSGSNSA 134 Query 155 --------------APFYYRVSPYAVIVVQYRIEQIDTKLKQQRREAETRDVFVCPICG 199 P +R++PY VV+++ I ++ Q+ ++A D +C C Sbjct 135 YFINNSTGLPSNRIGPSSFRINPYLPAVVEWQYNTIIREIDQEIKDAVNLDELMCNRCN 193 Lambda K H 0.316 0.130 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 48387021971 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40