bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1975_orf4 Length=181 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0204917 82.4 6e-15 > 44689.DDBDRAFT_0204917 Length=150 Score = 82.4 bits (202), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 42/102 (41%), Positives = 69/102 (67%), Gaps = 4/102 (3%) Query 75 MTLEALKSCDG-EKSEKLFVAVKGLVFDVSVNGKTFYGKNGSYHIFAGKDATVALARMSF 133 +LE +K G ++++ +F+A+KG ++DV+ K+ YG GSYH+FAG DATV LA+ SF Sbjct 48 YSLEEIKDFKGIDETKPIFIAIKGKIYDVTAK-KSTYGPGGSYHLFAGNDATVCLAKSSF 106 Query 134 DEKLLNSPPS--TWESLTESEKESLQSWLQRFKSKYSLVAVV 173 +E +N P + + + LT +K+SL++W+ F +Y+LV V Sbjct 107 EESDINQPWTNQSLDDLTADQKDSLKNWIDFFSERYTLVGNV 148 Lambda K H 0.313 0.126 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37665090561 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40