bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1974_orf1 Length=162 Score E Sequences producing significant alignments: (Bits) Value 4952.YALI0E34287g 108 8e-23 > 4952.YALI0E34287g Length=180 Score = 108 bits (269), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 1/86 (1%) Query 76 MRPLTEDEIKLVLEKLSKFLGDNLLHLIENSSDPHVFRLHRDRVFFLSEKLLKAAGCVPR 135 MRPLTE+E K V EKL+ ++G N+ H I N+ DPHVFRL +DRV+++ EK+ K A CV R Sbjct 1 MRPLTEEETKTVFEKLANYVGRNISHFI-NNEDPHVFRLQKDRVYYVEEKIAKYATCVSR 59 Query 136 KNLLSVGQCIGKITKGRKFRLGITAL 161 L SVG C+GK TK KFRL ITAL Sbjct 60 AQLFSVGTCLGKFTKTGKFRLHITAL 85 Lambda K H 0.324 0.139 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 27386790332 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40