bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1932_orf1 Length=181 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G15520.1 147 1e-34 > 3702.AT5G15520.1 Length=143 Score = 147 bits (372), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 0/138 (0%) Query 42 TVKDVTAQTFIEAYANHLKKRGKFQVPMWADLVKTGYGKSLAPHDPDWIFKRAAAILRHL 101 TVKDV+ F++AYA+HLK+ GK ++P+W D+VKTG K LAP+DPDW + RAA++ R + Sbjct 6 TVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARKI 65 Query 102 YLRPSCGVGAFRKVFSCKSGKKCSPGHTSKASGKIIRYILQQFETMGLVESRPDNGRRLT 161 YLR GVGAFR+++ P H K+SG I R+ILQQ ETM +VE GRR+T Sbjct 66 YLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMSIVELDTKGGRRIT 125 Query 162 KVGQKELDVIARQCVAPS 179 GQ++LD +A + A S Sbjct 126 SSGQRDLDQVAGRIAAES 143 Lambda K H 0.322 0.137 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37665090561 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40