bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1897_orf3 Length=155 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_1840 159 3e-38 > 5807.cgd7_1840 Length=676 Score = 159 bits (402), Expect = 3e-38, Method: Composition-based stats. Identities = 70/119 (58%), Positives = 91/119 (76%), Gaps = 0/119 (0%) Query 37 FILANTGPISDYYLMDKTIGRGTWGEVKLVVDKQTKARRAAKKIPKCYIEDAERFRQEIE 96 FIL+ G I+ YY ++ TIGRG+WGEVK+ V K T+ RRAAKKIPK ++ED +RF+QEIE Sbjct 194 FILSTKGDINQYYTLENTIGRGSWGEVKIAVQKGTRIRRAAKKIPKYFVEDVDRFKQEIE 253 Query 97 IMKALDHPNIVRLFETFEDASAFYLVMEFCGGGELFDRLLAAGALTERLACAVMRQVLA 155 IMK+LDHPNI+RL+ETFED + YLVME C GGELF+R++ E A +M+ VL+ Sbjct 254 IMKSLDHPNIIRLYETFEDNTDIYLVMELCTGGELFERVVHKRVFRESDAARIMKDVLS 312 Lambda K H 0.323 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40