bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1876_orf1 Length=137 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_2390 109 2e-23 > 5807.cgd3_2390 Length=381 Score = 109 bits (273), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 50/113 (44%), Positives = 77/113 (68%), Gaps = 1/113 (0%) Query 23 QELSSPQAVEKLKAAAEIANAALRQVLARVVPGADVFELCLFGDLFVAKEAAKVYQRKAK 82 + +S+ + V K AAEI N+ L+ V+ + GAD+ E+C D + ++++ VY +K Sbjct 17 ESISNSEVVTKYYTAAEIVNSTLQYVITLCLDGADISEICRKSDSMIEEKSSSVYNKKEG 76 Query 83 AKKIEKGIAVPTCVSVNEMFANFSPCDRSASLLLREGDLVKVHLGAHIDGFVA 135 +K++KGIA PTC+SVNE+ NFSP + SL L+ GDL+K+ LGAHIDGF++ Sbjct 77 GRKLDKGIAFPTCISVNEICGNFSPLP-AESLKLKNGDLIKIDLGAHIDGFIS 128 Lambda K H 0.319 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40