bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1827_orf2 Length=207 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0681 70.1 4e-11 > 5833.PF14_0681 Length=488 Score = 70.1 bits (170), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 38/137 (27%), Positives = 69/137 (50%), Gaps = 2/137 (1%) Query 15 RNKTFQNINLNFVAAGIVPSGTGNDWANSYGWTRASFPRKNPLRRKNFTRLLNTLESSVL 74 + + NIN N A G++P GTGND+A ++GW + + ++++ S + Sbjct 153 KEAEYYNINDNNFAIGVIPFGTGNDFAKAFGWKKIDRMLNHSFLFDVLKKIVDQTFKSKV 212 Query 75 AQHDCWKVTVAAKKG--FRAFSAAAQQLQQLGPDRHGSELKKTFFMSNYFSLGFEGLVGT 132 +HD W + V K+ F ++ ++ + L D + + MSNYFS+G + +G Sbjct 213 EKHDYWNIHVVLKEQGYFNKINSRTKKKETLLNDDKENLHEMKLCMSNYFSIGIDSRIGR 272 Query 133 DFDRVRGSSRLWNRGVY 149 F+R R S + N+ +Y Sbjct 273 GFERHRQKSAVCNKFIY 289 Lambda K H 0.322 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 52061985665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40