bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1823_orf1 Length=173 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000016753 210 2e-53 > 7719.ENSCINP00000016753 Length=479 Score = 210 bits (534), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 0/148 (0%) Query 3 QPLKEADPELYALLAKEKERQVDCIELIASENFVSTAVQECLGSCLTNKYSEGSVGARYY 62 QPL+E DPE+Y ++ EKERQ D +ELIASENF S AV E LGSCL NKYSEG G RYY Sbjct 19 QPLEENDPEIYRIIRNEKERQRDGLELIASENFTSGAVLEALGSCLNNKYSEGYPGVRYY 78 Query 63 GGMEFVDQIEALCIQRAKEAFGLDPEEWHVNVQPHSGSPANFAVLMALLQPHDRFMGLGL 122 GG E +D++E LC +RA E F L+PEEW VNVQP+SGSPANFAVL A+++PH R MGL L Sbjct 79 GGTENIDELERLCQKRALEVFKLNPEEWGVNVQPYSGSPANFAVLTAIVEPHGRIMGLDL 138 Query 123 NDGGHLTHGAYTPSRRISATSLFYESLP 150 DGGHLTHG T ++ISATS+F+ES+P Sbjct 139 PDGGHLTHGFMTEKKKISATSIFFESMP 166 Lambda K H 0.320 0.135 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 33476963958 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40