bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1790_orf2 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_4090 145 3e-34 > 5807.cgd5_4090 Length=1274 Score = 145 bits (366), Expect = 3e-34, Method: Composition-based stats. Identities = 67/124 (54%), Positives = 94/124 (75%), Gaps = 5/124 (4%) Query 1 IVDEAHERSINVDLLLGLVSRVVVMRRERFERG-----KDTLPPLKVLVMSATLKATDFT 55 ++DEAHER++N D+L+GL+SR+V+ RRE + R +D LPPLK+++MSATL+ TDF+ Sbjct 395 LIDEAHERTVNTDILIGLLSRIVIFRREEYIRKTKQGLEDKLPPLKLIIMSATLRVTDFS 454 Query 56 ENSHLFTPPPALLHLESRTFEVRVHFSKKTPDHYVDAAVKKALQIHTRLPAGSVLVFLTG 115 EN LF+ PP ++++E+ F V +HFSK TP Y+ AA KK QIH RLP GS+LVF+TG Sbjct 455 ENPKLFSKPPPVINIETPNFPVTLHFSKTTPKDYISAAYKKIQQIHNRLPPGSILVFVTG 514 Query 116 RAEV 119 + EV Sbjct 515 KKEV 518 Lambda K H 0.318 0.132 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40