bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1784_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL1475w 212 2e-54 > 5833.PFL1475w Length=376 Score = 212 bits (540), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 98/151 (64%), Positives = 115/151 (76%), Gaps = 1/151 (0%) Query 1 GKIYLHDVRERMLQEAKKRLKRAGITNYTIVEPGNPTLSKLLGAMDWVVCDVPCSGTGAL 60 GKIYLHD+R++ML +AK RL+RAGI NY ++ + L KL G MD V+ D PC+GTGAL Sbjct 225 GKIYLHDIRDQMLSQAKIRLRRAGIQNYILLNSNHILLKKLFGYMDVVIVDAPCTGTGAL 284 Query 61 RRNPEMKWKYKDEKLMDFVALQRHIFSSALQYAKPKTGKIVYITCSILDEENVHQAKFFC 120 RRNPEMK+K+ + KL D+V QR IF +AL Y K K GKIVYITCSILD ENVHQAK+FC Sbjct 285 RRNPEMKYKFTNNKLYDYVKTQREIFENALLYLK-KNGKIVYITCSILDAENVHQAKYFC 343 Query 121 QKHGLVLTEPPFHSLPTSHGMDGFFCAIFSR 151 QKH L L+E PFHSLP S MDGFF A F R Sbjct 344 QKHNLYLSEAPFHSLPQSKAMDGFFLATFER 374 Lambda K H 0.323 0.138 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40