bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1705_orf4 Length=394 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1365c 96.7 1e-18 > 5833.PFF1365c Length=10287 Score = 96.7 bits (239), Expect = 1e-18, Method: Composition-based stats. Identities = 46/109 (42%), Positives = 74/109 (67%), Gaps = 4/109 (3%) Query 11 RRSYSSSKMMVQVGPSDLPIEMSAYLFLRPLLTNLTSSTLWRNIIEKLGYSGREQP--SL 68 + Y+S+KM++ +G SDLPI++S+YLF++ LL + T LW+ ++ + S E+ +L Sbjct 9534 KNMYTSNKMVLAMGSSDLPIQLSSYLFIKKLLKHDTCLKLWKECLKYITSSSSEKSNLTL 9593 Query 69 KLDRGQAATAKVLAHTLWYQATVQLLSAAASPCKLRARPGERPCQNIFI 117 ++DRG AATAK +AHT+WYQ+T LL+ KLR +P +RP +F+ Sbjct 9594 RIDRGMAATAKHIAHTMWYQSTYSLLNIDTD--KLRGKPRDRPFMVVFV 9640 Lambda K H 0.318 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 156453723624 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40