bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1676_orf1 Length=193 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_2320 157 1e-37 > 5807.cgd2_2320 Length=1686 Score = 157 bits (398), Expect = 1e-37, Method: Composition-based stats. Identities = 71/178 (39%), Positives = 107/178 (60%), Gaps = 0/178 (0%) Query 16 SAVLMTLEKAKSEAAARTKRKHVVAAEYLLRAYIYTARKISSPSGALPNPIVQVTCAGVT 75 SA+L+++ K + + RTKR + +Y LR Y+Y R ++ NP + V+C GV Sbjct 554 SAILISISKQFASSVKRTKRHTIKCIDYELRCYLYACRNLNETGKDRTNPYIVVSCNGVY 613 Query 76 KETEPCEATSNPVFMECLHLELRLMTDTTTRLPTVVPIVTSLFDDRSWGRQLLGRAVCHY 135 + T+NP F+ECL L +++ +D T PTV PI S+F SWG++ +G C Y Sbjct 614 TTSSVKVNTNNPTFLECLFLRVKIESDPLTSFPTVAPITISVFSRHSWGKRFIGLCTCIY 673 Query 136 DRLRGKLKPGEIPSVAEPRWIKLKGGQRLNKHRGDILVCFELIRKKDAEVLPAYPMRP 193 DR+ G+ K E S EP WIKLKGG RLN H GDIL+C ++++ D++++P P+ P Sbjct 674 DRINGRNKNNEPISTLEPFWIKLKGGARLNNHVGDILLCIDIVKLCDSKMVPPQPLFP 731 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 44278360200 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40