bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1670_orf1 Length=178 Score E Sequences producing significant alignments: (Bits) Value 5833.PFB0410c 87.8 1e-16 > 5833.PFB0410c Length=679 Score = 87.8 bits (216), Expect = 1e-16, Method: Composition-based stats. Identities = 41/136 (30%), Positives = 77/136 (56%), Gaps = 3/136 (2%) Query 43 GVEPKTLRSELVDKFGWRFLNTLNAPLGTITCSDIAQSPPQQFVLRTYEHTSPASHVRSL 102 G + ++ +++ G +F+++ +T +D+ P + F++R Y H + + S Sbjct 427 GYDVNNVKDVFLERMGNKFMSSYKKFYCFVTATDVKHKPYKLFLIRNYTHKYNSINAESY 486 Query 103 RGTSRCPLWVAAWATIASPGSLRPIRPADLEGMGFSVEPKVCLTGSTSTSALAANPTLAG 162 G ++ PLW+AAWAT ++P L+ D++ +G +++P++ L + A+NP L Sbjct 487 DGINKVPLWLAAWATASAPTYLKGPSAEDIKKLGINIKPEIHLVDG---ALKASNPALIA 543 Query 163 LEECARLAHKPLRSFI 178 LEECARL +K L +FI Sbjct 544 LEECARLNNKNLSTFI 559 Lambda K H 0.320 0.134 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35812709058 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40