bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1659_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1185w 177 6e-44 > 5833.PFF1185w Length=2719 Score = 177 bits (450), Expect = 6e-44, Method: Composition-based stats. Identities = 86/129 (66%), Positives = 103/129 (79%), Gaps = 11/129 (8%) Query 1 ISTRAGGLGINLTAANHVVIYDHDWNPFIDLQAVDRAHRIGQQREVHVWSLVSEWTVEER 60 ISTRAGGLGINLTAANHV++YD DWNPFIDLQA+DRAHRIGQ+REV+VW L++EWTVEER Sbjct 1151 ISTRAGGLGINLTAANHVIMYDEDWNPFIDLQAIDRAHRIGQKREVNVWKLMTEWTVEER 1210 Query 61 MAFRREQKLRLDKLLVQQQIEEEALALDGEDGEDIKEHRSEKISTDEVRKLMLHGKKAIV 120 MAFRREQKL+LDKL+VQ Q D ED+ ++ EK+S+DE+RKLMLHGK AI Sbjct 1211 MAFRREQKLKLDKLVVQTQ-----------DDEDMLDNFEEKLSSDEIRKLMLHGKAAIQ 1259 Query 121 QVAATGTED 129 + T + Sbjct 1260 NMDVESTNN 1268 Lambda K H 0.317 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40