bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1637_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000019085 79.7 2e-14 > 7955.ENSDARP00000019085 Length=451 Score = 79.7 bits (195), Expect = 2e-14, Method: Composition-based stats. Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 4/105 (3%) Query 14 HSSHPSVAYLRQIYQTEENLYFVLNYTGCVRLRDVLRRLSRAGVSLSIGAARLWAAEIVA 73 H HP L +Q EE LYF L+Y L +R++ S R ++AEIV Sbjct 28 HLDHPFFVKLYFTFQDEEKLYFGLSYAKNGELLKYIRKIG----SFDETCTRFYSAEIVC 83 Query 74 ALATLRQKGVLHRDIRPENIVVSEQGHLTLVDFYSALHLVPGTQQ 118 AL L QKG++HRD++PENI++SE+ H+ + DF +A L ++Q Sbjct 84 ALEYLHQKGIIHRDLKPENILLSEEMHIQITDFGTAKQLSSDSKQ 128 Lambda K H 0.322 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40