bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1631_orf1 Length=164 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1185w 182 3e-45 > 5833.PFF1185w Length=2719 Score = 182 bits (462), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 83/153 (54%), Positives = 110/153 (71%), Gaps = 5/153 (3%) Query 9 NDDKCFLCRKSDIEDESGGKLIMCDGCPHSYHMSCLKLTIEPDEEKWFCPDCNPAAFNTD 68 N+D+C +CR E + L++CDGCP+SYH+SCL L EP+ EKW+CP C P Sbjct 68 NEDRCKICR----EKSANLILLLCDGCPNSYHVSCLGLAAEPESEKWYCPICKPDDHKNL 123 Query 69 EIRRLGRGSTAPR-SGDTVNSSTCYVCQRPGKLLGCDFCVNSFHPSCLVDVDWNSIGEEW 127 ++RR+ +G +G+ VNSSTCYVCQRPGKLLGCDFC NSFHP+CL D+D+++I ++W Sbjct 124 DVRRMRKGFVLDNMNGEHVNSSTCYVCQRPGKLLGCDFCPNSFHPTCLPDLDFDNISDQW 183 Query 128 ECPVCKGFDPLANQMHKRWTRQEIETKKKERAK 160 ECP CK DPL NQ HKRWT+ EI+ K+R + Sbjct 184 ECPCCKNEDPLLNQGHKRWTKNEIQEIMKKRQR 216 Lambda K H 0.320 0.136 0.463 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40