bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1604_orf3 Length=165 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL009145-PA 72.0 6e-12 > 7159.AAEL009145-PA Length=363 Score = 72.0 bits (175), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 45/148 (30%), Positives = 80/148 (54%), Gaps = 5/148 (3%) Query 2 KRYGFEELAVQLCRALVEEADKKVQTAQMRVDCASLPGVENVKSVHPEVLRLDQAIAQKF 61 K Y ++ A++ +A + + D++ + A+ R+ V + V L + I +K Sbjct 82 KDYYYDVDAMEHLQAFIADCDRRTEAAKKRLAETQEELTAEVAAKANAVHELAEEIGKKL 141 Query 62 KEMEDLGKLGRIDQSMGVSLELTSLQTRRAKLL--FRNA---EGQLTQRLRPCDVCGALL 116 + E LG+ G++++SM + E+ L+ R+AK +R+A Q+LR C+VC A L Sbjct 142 AKAEALGEAGQVEESMKLMSEIDELRARKAKAEQEYRSAIPASSYQQQKLRVCEVCSAYL 201 Query 117 SANDTDRRLDEHFSGRVHLGLQKLRDAL 144 +D D RL +HF G++HLG +R+ L Sbjct 202 GIHDNDVRLADHFGGKLHLGFLAIREKL 229 Lambda K H 0.320 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 29254071491 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40