bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1582_orf1 Length=212 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_4910 184 1e-45 > 5807.cgd7_4910 Length=311 Score = 184 bits (468), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 81/177 (45%), Positives = 124/177 (70%), Gaps = 3/177 (1%) Query 39 LSGATLNDAILLFAFLYSSSDVFVEWEAFDTCSKPVHLWLLGSYVALVAFRLSHYLGQYL 98 ++G +NDAIL AF+YSS+D+ +W++F TC P+ LWL+ SY+ ++AFR+ HY+ YL Sbjct 1 MTGFGINDAILGLAFMYSSADLISQWDSFSTCCHPIQLWLIISYITIIAFRVIHYVSNYL 60 Query 99 SNDGEEFMLHRQ-RGPPFWVSVLILGILFPCFFGWTIVGTVWFLEIQEETPYCLPRE--S 155 S ++ + + G PFW+++ ++ ++FP F WT+VGTVW I+ +TP CL S Sbjct 61 SEGSDDVLPYSSTSGIPFWLNLSVVCLIFPFFLSWTVVGTVWLKNIESKTPQCLAGNGSS 120 Query 156 HPWFFTFWLALCYIWILIYIIFIATAVVCEYRARRMERDLQILQNEDMIRRWGRIRI 212 HPWF FWL LCYIWI+ Y FI+ ++ E+R RR E DL +L+N++++RRWGR+R+ Sbjct 121 HPWFLIFWLVLCYIWIVAYTAFISISIFFEFRVRRAEEDLLLLENDEVMRRWGRLRL 177 Lambda K H 0.331 0.144 0.493 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 54290949897 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40