bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1579_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000019736 106 2e-22 > 8090.ENSORLP00000019736 Length=841 Score = 106 bits (265), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 54/112 (48%), Positives = 76/112 (67%), Gaps = 2/112 (1%) Query 1 ELNFEDLKASCRYEG-YSPDSPYIKSLWDILFSFDTFQKQNFLKFVSGSERSPAFGLSEL 59 +L+FE L+ + Y+G Y+ D+ IK W+ + SF QK+ FL+F +G++R+P GL +L Sbjct 730 KLDFEALERTTDYDGGYTKDTQVIKDFWETIHSFSDEQKRLFLQFTTGTDRAPVGGLGKL 789 Query 60 RMTIQKNGGEPTERLPTSFTCFCTFLLPEYGTKEKLERLLTIAIEASEGFGL 111 +M I KNG + T+RLPTS TCF LLPEY +KEKL L AI +EGFG+ Sbjct 790 KMIIAKNGSD-TDRLPTSHTCFNALLLPEYSSKEKLRERLLKAITYAEGFGM 840 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40